@SliverDaemoni
iAccount based inUnited States
About this account
- Account based in
- United States
- Connected via
- Web
Account-level information from X, not a live location or the device used for a specific post.
a clockwork purple
Joined January 2024
- Tweets517
- Following421
- Followers24
- Likes2.1K
Daemon Sliver retweeted
(1/12) Over a year ago, we launched a new project to explore whether the tissue microenvironment could predict cellular behaviour and whether reprogramming might unlock new therapeutic avenues. 🧬 Spatial transcriptomics provides deep insights into tissue organisation.
We wanted to take this further by building a model that predicts how the tissue microenvironment rewires cells, and in silico predict how reprogramming influences the diseased microenvironment. Today, in collaboration with @Muzz_Haniffa at @sangerinstitute we’re excited to share the preprint for Mintflow, including two novel disease datasets.
Link to preprint: shorturl.at/alFUO 🧵
Daemon Sliver retweeted
A new study from NYU Langone outlines a potential AI-based method to help track aging cells. The tool assigns a “senescence score” based on nuclear features, which may aid future research in aging and disease.
🧬 Read: doi.org/10.1038/s41467-025-6…
Daemon Sliver retweeted
Update on a new interpretable decomposition method for LLMs -- sparse mixtures of linear transforms (MOLT). Preliminary evidence suggests they may be more efficient, mechanistically faithful, and compositional than existing techniques like transcoders transformer-circuits.pub/202…
Daemon Sliver retweeted
We're launching an "AI psychiatry" team as part of interpretability efforts at Anthropic! We'll be researching phenomena like model personas, motivations, and situational awareness, and how they lead to spooky/unhinged behaviors. We're hiring - join us! job-boards.greenhouse.io/ant…
Daemon Sliver retweeted
The new single from 'River of Music', 'Handel: Sonata for 2 Cellos', is out now! You can pre-order the album here: KannehMason.lnk.to/RiverOfMu… 🙏🏽
Listen to the new single: kannehmason.lnk.to/HandelSon…
Daemon Sliver retweeted
🚀 Introducing GLiClass‑V3 – a leap forward in zero-shot classification!
Matches or beats cross-encoder accuracy, while being up to 50× faster. Real-time inference is now possible on edge hardware.
huggingface.co/collections/k…
#TextClassification #NLP #ZeroShot #GLiClass
Daemon Sliver retweeted
How challenging is the prediction of transcriptional responses to CRISPR gene perturbations ?
A simple model, just scaling RNA correlation vectors, results in accurate predictions for many perturbations.
The model is intuitive & grounded in a simple approximation.
1/2
Daemon Sliver retweeted
Evo 2 update: new dependency versions (torch, transformer engine, flash attn) and a docker option mean it should be easy to setup without needing to compile locally.
Happy ATGC-ing!
github.com/ArcInstitute/evo2
Daemon Sliver retweeted
my emotional biotech portfolio:
rowansci.com
noetik.ai
axi.om
popvax.com
convoke.bio
formation.bio
markov.bio
futurehouse.org
newlimit.com
leash.bio
Daemon Sliver retweeted
Here is a fascinating essay outlining Markov Bio's thesis: foundation models based on observational scRNA data are severely underrated. They got a bad initial reputation, but early models had big problems: too small, weird architectures, and more.
markov.bio/research/mech-int…
To me, this is a wildly unexpected take. So it's especially interesting that Markov Bio is currently (July 19 12pm) atop the Arc competition leaderboard. virtualcellchallenge.org/lea…
Daemon Sliver retweeted
1/ You're not just sequencing single cells.
You're sequencing the soup they're in.
Ambient RNA is everywhere in single-cell RNA-seq. Here's how to fix it.
Daemon Sliver retweeted
Design Of Intrinsically Disordered Region Binding Proteins @ScienceMagazine
🚀 New paper published from David Baker!🚀
A groundbreaking computational approach has been developed to design proteins that can specifically bind to intrinsically disordered regions (IDRs), which are highly flexible and lack a defined 3D structure. This innovation addresses a significant challenge in protein engineering where traditional methods often struggle with such dynamic targets.
The key breakthrough lies in leveraging the inherent flexibility of IDRs. Instead of being a hurdle, the designed binding proteins actually guide the disordered target sequences into specific, binding-competent conformations, enabling high-affinity and highly specific interactions. This is a paradigm shift from targeting rigid structures.
This novel pipeline integrates physics-based methods with advanced deep learning techniques, specifically RFdiffusion, to create a versatile library of protein scaffolds with specialized binding pockets. This library allows for the precise recognition of diverse extended peptide conformations.
The researchers demonstrated the effectiveness of their method by designing binders for 39 out of 43 diverse synthetic and therapeutically relevant IDRs, including those related to GPCR signaling and cancer. These binders consistently achieved picomolar to nanomolar affinities.
The designed binders exhibited remarkable specificity, binding tightly to their intended targets even when faced with highly similar sequences, as confirmed by comprehensive all-by-all binding experiments. They also proved functional in cellular contexts for applications like enriching low-abundance proteins for proteomics and influencing protein localization.
Structural validation through co-crystal structures and nuclear magnetic resonance (NMR) data corroborated the computational design, showing that the designed binders successfully induce the disordered targets into specific bound conformations.
💻Code: zenodo.org/records/14829674
📜Paper: science.org/doi/10.1126/scie…
#ComputationalBiology #ProteinDesign #IDPs #DrugDiscovery #DeepLearning #StructuralBiology #Science
Daemon Sliver retweeted
Spatial biology is moving quickly and offers much to be excited about.
But there is still a big learning curve. Especially with analysis.
If you are a scientist new to spatial techniques, how do you actually analyze your data? A concrete tutorial from prep to insight follows:
Daemon Sliver retweeted
Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck!
>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
Daemon Sliver retweeted
Source: this tour-de-force in today's Cell cell.com/cell/abstract/S0092…
Daemon Sliver retweeted
So, exercise is anti-cancer
This is partly because exercise boosts the immune system - killer T cells - and this seems to be because of Formate production by gut bacteria
Daemon Sliver retweeted
No MSA? 🔥 No problem🔎
PLAME turns ESM-2 embeddings into virtual MSAs, HiFiAD-filters them and lifts pLDDT +5 on zero-shot CASP14 targets
AlphaFold2 accuracy at near-ESMFold latency🔥
Daemon Sliver retweeted
Our research on embodied AI agents that can perceive, learn, act and interact in the virtual and physical worlds. #metaAI #AIAgent #embodied #worldmodel #superintelligemce
arxiv.org/abs/2506.22355